PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P31150_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family BES1
Protein Properties Length: 295aa    MW: 32067 Da    PI: 9.4938
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P31150_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222013.8e-6241422145
                 DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssasa 88 
                            g+gr ptwkErEnnkrRERrRRaiaaki++GLR  Gnyklpk++DnneVlkALcreAGw vedDGttyrkg++p+  ea+a+g s+++
  GSMUA_Achr8P31150_001   4 GGGRLPTWKERENNKRRERRRRAIAAKIFTGLRTLGNYKLPKHCDNNEVLKALCREAGWEVEDDGTTYRKGFHPPpPEAAAGGLSTNI 91 
                            89*************************************************************************8888999999999 PP

                 DUF822  89 spesslqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlsl 145
                            sp ss+         +spv+sy+asp+sssfpsps+ld+ + +s   ++llp+l++ls+
  GSMUA_Achr8P31150_001  92 SPLSSSF--------PSPVPSYHASPSSSSFPSPSRLDNSNDHSVrpSCLLPFLRNLST 142
                            9999955........***********************998877677999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.2E-594141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTSGGGRLPT WKERENNKRR ERRRRAIAAK IFTGLRTLGN YKLPKHCDNN EVLKALCREA  60
GWEVEDDGTT YRKGFHPPPP EAAAGGLSTN ISPLSSSFPS PVPSYHASPS SSSFPSPSRL  120
DNSNDHSVRP SCLLPFLRNL STLPPLRISN SAPITPPISS PTASRPPKIR KPDWDYSSFP  180
HALFAASAPA SPTRGCHHGR QPSTIPECDE SDASSVGSGR RINFQMTAPA SPTYNLVNPG  240
AMSSFPGGEV LEKGRGGMEF DFESGRVKAW EGERIHDVGL DELELTLRLG IMAPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009414760.10.0PREDICTED: protein BZR1 homolog 1-like
SwissprotB8B7S51e-106BZR1_ORYSI; Protein BZR1 homolog 1
SwissprotQ7XI961e-106BZR1_ORYSJ; Protein BZR1 homolog 1
TrEMBLM0TV670.0M0TV67_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P31150_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54743453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.23e-57BES1 family protein